TMEM184A Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM184A

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane protein 184A

Protein Size: 413

Purification: Affinity Purified

• SKU: AVIARP54530_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54530_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 202915
• Host: Rabbit