TMF1 Antibody - N-terminal region : HRP

TMF1 Antibody - N-terminal region : HRP
SKU
AVIARP58092_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMF1

Key Reference: Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485

Molecular Weight: 123kDa

Peptide Sequence: Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TATA element modulatory factor

Protein Size: 1093

Purification: Affinity Purified
More Information
SKU AVIARP58092_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58092_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7110
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×