Tmlhe Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Tmlhe is a first enzyme in the carnitine biosynthesis pathway and plays an important role in the transport of fatty acids across the inner mitochondrial membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmlhe

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trimethyllysine dioxygenase, mitochondrial

Protein Size: 433

Purification: Affinity Purified

• SKU: AVIARP57146_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57146_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 170898
• Host: Rabbit