TMOD2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMOD2

Key Reference: Pawlak,G., (2004) Int. J. Cancer 110 (3), 368-373

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tropomodulin-2

Protein Size: 351

Purification: Affinity Purified

• SKU: AVIARP55079_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55079_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29767
• Host: Rabbit