TMOD2 Antibody - N-terminal region : HRP

TMOD2 Antibody - N-terminal region : HRP
SKU
AVIARP55080_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMOD2

Key Reference: Pawlak,G., (2004) Int. J. Cancer 110 (3), 368-373

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tropomodulin-2

Protein Size: 351

Purification: Affinity Purified
More Information
SKU AVIARP55080_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55080_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29767
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×