TMPRSS3 Antibody - N-terminal region : FITC

TMPRSS3 Antibody - N-terminal region : FITC
SKU
AVIARP57683_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMPRSS3

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane protease serine 3

Protein Size: 454

Purification: Affinity Purified
More Information
SKU AVIARP57683_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57683_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64699
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×