TNFRSF4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNFRSF4

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor necrosis factor receptor superfamily member 4

Protein Size: 277

Purification: Affinity Purified

• SKU: AVIARP59086_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59086_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7293
• Host: Rabbit
• Conjugate: Conjugated, HRP