TNKS1BP1 Antibody - middle region : HRP

TNKS1BP1 Antibody - middle region : HRP
SKU
AVIARP58347_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNKS1BP1

Key Reference: Gelmini,S., (2007) Clin. Chem. Lab. Med. 45 (7), 862-866

Molecular Weight: 190kDa

Peptide Sequence: Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 182 kDa tankyrase-1-binding protein

Protein Size: 1729

Purification: Affinity Purified
More Information
SKU AVIARP58347_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58347_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 85456
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×