TNPO2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TNPO2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transportin-2

Protein Size: 887

Purification: Affinity Purified

• SKU: AVIARP54956_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54956_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 30000
• Host: Rabbit