TOB2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TOB2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Tob2

Protein Size: 344

Purification: Affinity Purified

• SKU: AVIARP58112_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58112_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10766
• Host: Rabbit