TP53INP2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of TP53INP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TP53INP2

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor protein p53-inducible nuclear protein 2

Protein Size: 220

Purification: Affinity Purified

• SKU: AVIARP58965_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58965_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 58476
• Host: Rabbit
• Conjugate: Conjugated, Biotin