TRAPPC4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC4

Key Reference: Gavin,A.C., (2002) Nature 415 (6868), 141-147

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trafficking protein particle complex subunit 4

Protein Size: 219

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP56842_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56842_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51399
• Host: Rabbit