TRIB2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB2

Key Reference: Lin,K.R., (2007) J. Biol. Chem. 282 (30), 21962-21972

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tribbles homolog 2

Protein Size: 343

Purification: Affinity Purified

• SKU: AVIARP55377_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55377_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 28951
• Host: Rabbit