TRIB2 Antibody - middle region : FITC

TRIB2 Antibody - middle region : FITC
SKU
AVIARP55377_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIB2

Key Reference: Lin,K.R., (2007) J. Biol. Chem. 282 (30), 21962-21972

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tribbles homolog 2

Protein Size: 343

Purification: Affinity Purified
More Information
SKU AVIARP55377_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55377_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 28951
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×