Trim3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Trim3 is probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation.

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: FFISSLMEAMQQAPEGAHDPEDPHPLSAVAGRPLSCPNHEGKTMEFYCEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 3

Protein Size: 744

Purification: Affinity Purified

• SKU: AVIARP57941_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57941_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55992
• Host: Rabbit