TRIM31 Antibody - middle region : HRP

TRIM31 Antibody - middle region : HRP
SKU
AVIARP57948_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Key Reference: Shiina,T., (2006) Genetics 173 (3), 1555-1570

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 ubiquitin-protein ligase TRIM31

Protein Size: 425

Purification: Affinity Purified
More Information
SKU AVIARP57948_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57948_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11074
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×