TRIM38 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRIM38 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM38

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tripartite motif-containing protein 38

Protein Size: 465

Purification: Affinity Purified

• SKU: AVIARP57852_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57852_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10475
• Host: Rabbit