TRIM49 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM49

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: NMYRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 452

Purification: Affinity Purified

• SKU: AVIARP58058_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58058_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57093
• Host: Rabbit