TRMT6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is similar to an uncharacterized protein from C. elegans. Although the function of the encoded protein is unknown, it shares weak sequence similarity to a region of S. cerevisiae translation initiation factor subunit Gcd10p.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRMT6

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6

Protein Size: 497

Purification: Affinity Purified

Subunit: TRM6

• SKU: AVIARP56780_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56780_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51605
• Host: Rabbit