TRPC6 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPC6

Key Reference: Liu,D., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (4), 746-751

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Short transient receptor potential channel 6

Protein Size: 931

Purification: Affinity Purified

• SKU: AVIARP58718_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58718_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7225
• Host: Rabbit
• Conjugate: Conjugated, HRP