TSPYL4 Antibody - middle region : FITC

TSPYL4 Antibody - middle region : FITC
SKU
AVIARP55378_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPYL4

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testis-specific Y-encoded-like protein 4

Protein Size: 414

Purification: Affinity Purified
More Information
SKU AVIARP55378_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55378_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23270
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×