TTC27 Antibody - N-terminal region : Biotin

TTC27 Antibody - N-terminal region : Biotin
SKU
AVIARP57019_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of TTC27 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TTC27

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tetratricopeptide repeat protein 27

Protein Size: 843

Purification: Affinity Purified
More Information
SKU AVIARP57019_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57019_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55622
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×