TUBB Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TUBB

Key Reference: Wiesen,K.M., (2007) Cancer Lett. 257 (2), 227-235

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin beta chain

Protein Size: 444

Purification: Affinity Purified

• SKU: AVIARP55761_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55761_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 203068
• Host: Rabbit