Tubb2a Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tubb2a

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin beta-2A chain

Protein Size: 445

Purification: Affinity Purified

• SKU: AVIARP58545_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58545_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22151
• Host: Rabbit