TUBE1 Antibody - middle region : Biotin

TUBE1 Antibody - middle region : Biotin
SKU
AVIARP56869_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBE1

Key Reference: Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin epsilon chain

Protein Size: 475

Purification: Affinity Purified
More Information
SKU AVIARP56869_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56869_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 51175
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×