TUBE1 Antibody - middle region : HRP

TUBE1 Antibody - middle region : HRP
SKU
AVIARP56868_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBE1

Key Reference: Chang,P. (2000) Nat. Cell Biol. 2 (1), 30-35

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulin epsilon chain

Protein Size: 475

Purification: Affinity Purified
More Information
SKU AVIARP56868_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56868_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51175
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×