TUBG2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUBG2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulin gamma-2 chain

Protein Size: 451

Purification: Affinity Purified

• SKU: AVIARP55345_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55345_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27175
• Host: Rabbit