Twf1 Antibody - C-terminal region : FITC

Twf1 Antibody - C-terminal region : FITC
SKU
AVIARP56488_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Twf1 is an actin-binding protein involved in motile and morphological processes. It inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles.

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Twinfilin-1

Protein Size: 350

Purification: Affinity Purified
More Information
SKU AVIARP56488_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56488_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 315265
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×