TXN2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXN2

Key Reference: Benhar,M., (2008) Science 320 (5879), 1050-1054

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thioredoxin, mitochondrial

Protein Size: 166

Purification: Affinity Purified

• SKU: AVIARP54910_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54910_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 25828
• Host: Rabbit