TXNDC4 Antibody - middle region : Biotin

TXNDC4 Antibody - middle region : Biotin
SKU
AVIARP58726_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4

Key Reference: Mariappan,M., (2008) J. Biol. Chem. 283 (10), 6375-6383

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endoplasmic reticulum resident protein 44

Protein Size: 406

Purification: Affinity Purified
More Information
SKU AVIARP58726_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58726_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23071
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×