TYMSOS Antibody - N-terminal region : Biotin

TYMSOS Antibody - N-terminal region : Biotin
SKU
AVIARP56201_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C18orf56

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TYMS opposite strand protein

Protein Size: 123

Purification: Affinity Purified
More Information
SKU AVIARP56201_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56201_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 494514
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×