UBXN1 Antibody - middle region : FITC

UBXN1 Antibody - middle region : FITC
SKU
AVIARP56764_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC51035

Key Reference: Wilson,P.A., (2006) J. Lipid Res. 47 (9), 1940-1949

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UBX domain-containing protein 1

Protein Size: 312

Purification: Affinity Purified
More Information
SKU AVIARP56764_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56764_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51035
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×