UCHL3 Antibody - N-terminal region : HRP

UCHL3 Antibody - N-terminal region : HRP
SKU
AVIARP58689_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UCHL3

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L3

Protein Size: 230

Purification: Affinity Purified
More Information
SKU AVIARP58689_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58689_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7347
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×