ULK3 Antibody - middle region : Biotin

ULK3 Antibody - middle region : Biotin
SKU
AVIARP58971_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ULK3 is the serine/threonine protein kinase which enhances GLI1 and GLI2 transcriptional activity and consequently positively regulates GLI-dependent SHH signaling. ULK3 may exert this function by promoting GLI1 nuclear localization. ULK3 phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ULK3

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase ULK3

Protein Size: 472

Purification: Affinity Purified
More Information
SKU AVIARP58971_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58971_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25989
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×