UNC45A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UNC45A

Key Reference: Chadli,A., (2008) J. Biol. Chem. 283 (15), 9509-9512

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein unc-45 homolog A

Protein Size: 929

Purification: Affinity Purified

• SKU: AVIARP56262_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56262_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 55898
• Host: Rabbit