UQCRFS1 Antibody - N-terminal region : Biotin

UQCRFS1 Antibody - N-terminal region : Biotin
SKU
AVIARP58549_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UQCRFS1

Key Reference: Xu,H., (2007) Acta Biochim. Biophys. Sin. (Shanghai) 39 (12), 964-973

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome b-c1 complex subunit Rieske, mitochondrial

Protein Size: 274

Purification: Affinity Purified

Subunit: Rieske, mitochondrial
More Information
SKU AVIARP58549_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58549_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7386
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×