UQCRFS1 Antibody - N-terminal region : HRP

UQCRFS1 Antibody - N-terminal region : HRP
SKU
AVIARP58549_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UQCRFS1

Key Reference: Xu,H., (2007) Acta Biochim. Biophys. Sin. (Shanghai) 39 (12), 964-973

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome b-c1 complex subunit Rieske, mitochondrial

Protein Size: 274

Purification: Affinity Purified

Subunit: Rieske, mitochondrial
More Information
SKU AVIARP58549_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58549_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7386
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×