URG4 Antibody - middle region : FITC

URG4 Antibody - middle region : FITC
SKU
AVIARP56288_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival (Tufan et al., 2002 [PubMed 12082552]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human URG4

Key Reference: Song,J., (2006) Neoplasia 8 (12), 995-1002

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ58708, weakly similar to Mus musculus GTPase, very large interferon inducible 1, transcript variant A, mRNA EMBL BAH13717.1

Protein Size: 888

Purification: Affinity Purified
More Information
SKU AVIARP56288_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56288_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55665
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×