USP12 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP12

Key Reference: Dunham,A., (2004) Nature 428 (6982), 522-528

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 12

Protein Size: 370

Purification: Affinity Purified

• SKU: AVIARP55812_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55812_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 219333
• Host: Rabbit