Usp12 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Usp12 is a deubiquitinating enzyme. It has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. It is not involved in deubiquitination of monoubiquitinated FANCD2.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Usp12

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: HSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 12

Protein Size: 370

Purification: Affinity Purified

• SKU: AVIARP55811_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55811_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22217
• Host: Rabbit