VASH1 Antibody - N-terminal region : FITC

VASH1 Antibody - N-terminal region : FITC
SKU
AVIARP55099_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VASH1

Key Reference: Yoshinaga,K., (2008) Cancer Sci. 99 (5), 914-919

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vasohibin-1

Protein Size: 365

Purification: Affinity Purified
More Information
SKU AVIARP55099_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55099_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22846
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×