VGLL3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VGLL3

Key Reference: Maeda,T., (2002) J. Biol. Chem. 277 (50), 48889-48898

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription cofactor vestigial-like protein 3

Protein Size: 326

Purification: Affinity Purified

• SKU: AVIARP55341_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55341_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 389136
• Host: Rabbit