VPS29 Antibody - N-terminal region : FITC

VPS29 Antibody - N-terminal region : FITC
SKU
AVIARP56858_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS29

Key Reference: Hierro,A., (2007) Nature 449 (7165), 1063-1067

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 29

Protein Size: 182

Purification: Affinity Purified
More Information
SKU AVIARP56858_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56858_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51699
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×