VTA1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VTA1

Key Reference: Ward,D.M., (2005) J. Biol. Chem. 280 (11), 10548-10555

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein VTA1 homolog

Protein Size: 307

Purification: Affinity Purified

• SKU: AVIARP56921_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56921_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51534
• Host: Rabbit