VTN Antibody - N-terminal region : Biotin

VTN Antibody - N-terminal region : Biotin
SKU
AVIARP58095_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VTN

Key Reference: Upton,Z., (2008) J. Invest. Dermatol. 128 (6), 1535-1544

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vitronectin

Protein Size: 478

Purification: Affinity Purified
More Information
SKU AVIARP58095_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58095_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7448
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×