Vwa5a Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Vwa5a may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in may contribute directly to or modify tumorigenesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: von Willebrand factor A domain-containing protein 5A

Protein Size: 793

Purification: Affinity Purified

• SKU: AVIARP55094_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55094_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 67776
• Host: Rabbit