WARS Antibody - N-terminal region : Biotin

WARS Antibody - N-terminal region : Biotin
SKU
AVIARP58550_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WARS

Key Reference: Shen,N., (2008) Nucleic Acids Res. 36 (4), 1288-1299

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tryptophan--tRNA ligase, cytoplasmic

Protein Size: 471

Purification: Affinity Purified
More Information
SKU AVIARP58550_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58550_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7453
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×