WBP2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WBP2

Key Reference: Dhananjayan,S.C., (2006) Mol. Endocrinol. 20 (10), 2343-2354

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WW domain-binding protein 2

Protein Size: 261

Purification: Affinity Purified

• SKU: AVIARP54911_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54911_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23558
• Host: Rabbit