WDFY1 Antibody - N-terminal region : FITC

WDFY1 Antibody - N-terminal region : FITC
SKU
AVIARP57465_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains a single FYVE domain and multiple WD40 repeats. This protein is localized to endosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDFY1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat and FYVE domain-containing protein 1

Protein Size: 410

Purification: Affinity Purified
More Information
SKU AVIARP57465_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57465_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57590
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×