WDPCP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC51057

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing and planar cell polarity effector protein fritz homolog

Protein Size: 618

Purification: Affinity Purified

• SKU: AVIARP56279_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56279_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51057
• Host: Rabbit